CADD

sucr1


Receptor detail information


Receptor name
sucr1
GPCRdb classification
001_008_003_001
PDB
(structure file)
Sequence
MAQNLSCENWLALENILKKYYLSAFYGIEFIVGMLGNFTVVFGYLFCMKNWNSSNVYLFNLSISDLAFLCTLPMLIRSYATGNWTYGDVLCISNRYVLHANLYTSILFLTFISIDRYLLMKFPFREHILQKKEFAILISLAVWVLVTLEVLPMLTFITSTPIEKGDSCVDYASSGNPKYSLIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKKRSQQQATVLSLNKPLRLVVLAVVIFSVLFTPYHIMRNVRIASRLDSWPQGCSQKAIKCLYILTRPLAFLNSAVNPIFYFLVGDHFRDMLFSKLRQYFKSLTSFRL
Scientific name
Rattus norvegicus
Common name
rat
Ligand function
antagonist
Snake plot